PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096327.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 149aa    MW: 16990.4 Da    PI: 10.6543
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096327.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.37.9e-3949107361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        +kcprCds+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+ 
  XP_011096327.1  49 PPPQKCPRCDSSNTKFCYYNNYSLSQPRYFCKGCRRYWTQGGTLRNVPVGGGCRKTKRP 107
                     56789**************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.7E-3352106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05952106IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-2553106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MQFMQSNMEQ RRNEEKLLKQ QQDQQQPPSR RLKPAEMQMA AAHNQHQPPP PQKCPRCDSS  60
NTKFCYYNNY SLSQPRYFCK GCRRYWTQGG TLRNVPVGGG CRKTKRPKPS IPSSSSSEIA  120
RTQSLSPALP SQNLTACSLY RPASIKGLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096327.11e-106PREDICTED: dof zinc finger protein DOF1.4-like isoform X2
TrEMBLA0A022QL736e-43A0A022QL73_ERYGU; Uncharacterized protein
STRINGVIT_10s0003g00030.t012e-37(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.15e-33TARGET OF MONOPTEROS 6